PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G03520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 682aa    MW: 70300.1 Da    PI: 6.5765
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G03520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-093844211954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  OGLUM11G03520.1 384 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 421
                      664459******************************88 PP

2BELL118.33.6e-38245316172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erqelq+kk kL+++l+eV++rY+qy++q+q+v++sFeavag gsa+ Yt+lAl++iSr+FrcL+daia+q+
  OGLUM11G03520.1 245 ERQELQMKKGKLINMLDEVEQRYRQYHQQMQVVVASFEAVAGGGSARTYTALALRTISRQFRCLRDAIAGQV 316
                      79*******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-61163314IPR006563POX domain
PfamPF075264.2E-50171313IPR006563POX domain
PROSITE profilePS5007112.26362425IPR001356Homeobox domain
SMARTSM003891.2E-9365429IPR001356Homeobox domain
CDDcd000863.77E-13365426No hitNo description
SuperFamilySSF466893.85E-17366432IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-29368431IPR009057Homeodomain-like
PfamPF059202.7E-18382421IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MAAYYHGGAG TDIQSGTDGL QTLYLMNPSY AGYGDAAAAA AAPGAAANMM LLNSAVTSMT  60
PVSFGHQPSP SPSSSSAAQH FVGIPLQAPP ASGYNLWTPA AATGAGDMSP PTPQHQHQQA  120
HGGGAAGVSA VLSLSSREAA PPVTVAAVVA AGDEGRYLQA VAQGAASQGQ MVMSSKYLKA  180
AQELLDEVVS VSKGVDDVKA AAAAKSPASV KKKEDSEGVS GGGTEDGGGA KSGGAPPPPE  240
MSTAERQELQ MKKGKLINML DEVEQRYRQY HQQMQVVVAS FEAVAGGGSA RTYTALALRT  300
ISRQFRCLRD AIAGQVRAAS RALGEAVDAD GGCGRTVGSR LRYIDHQLRQ QRALQQLGMM  360
QSNAWRPQRG LPERSVSILR AWLFEHFLHP YPKDSDKIML AKQTGLTRSQ VSNWFINARV  420
RLWKPMVEEM YLEETKDQDG GGGGAGDEGS KPGGSKGGGA GVNGGVVDSA AKMDSKAAHM  480
ESGGGVHPSL LELAGDHQAQ AGFYDDDDEE DGGAAAALQQ KLKKARTEEQ QQAAFHVSDV  540
ATLHAHAAAA AAARHDEVSH RELLMKFMES GSAGAGAAAR DHHHEHHGGV GYSLFAPAPY  600
GQFATEQFAF AGHGGGGGGG GVSLTLGLPH GAEQTASFLM TSSNGSDGAG HVAAGGGGGG  660
GYDMNMQSTK SFAAQLMRDF VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A2e-17371429159Homeobox protein Meis2
5bng_B2e-17371429159Homeobox protein Meis2
4xrm_B2e-17371429563Homeobox protein Meis2
4xrm_A2e-17371429563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1332170.0AC133217.2 Oryza sativa (japonica cultivar-group) chromosome 11 BAC clone OSJNBa0052H02, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankCU4066200.0CU406620.1 Oryza rufipogon (W1943) cDNA clone: ORW1943S102E10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616922.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_015616923.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_015616924.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_015616925.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-115BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0E0BFL30.0A0A0E0BFL3_9ORYZ; Uncharacterized protein
STRINGORGLA11G0035300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.33e-90BEL1-like homeodomain 1